
Cell Culture Growth Factors and Hormones
Highly defined, cell type-specific, and broad-spectrum supplements and hormones that stimulate and support cell proliferation and differentiation.
Form
- (10)
- (595)
- (21)
- (1)
- (4)
Conjugate
- (601)
For Use With (Application)
- (575)
- (575)
- (6)
- (14)
- (6)
Recombinant
- (589)
Species
- (575)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.

106
–
120
of
2,253
results
Invitrogen™ Human PHACTR2 Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | ISTRKSREELIRRGVLKELPDQDGDVTVNFENSNGHMIPIGEESTREENVVKSEEGNGSVSEKTPPLEEQAEDKKENTENHSETP |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human PHACTR2 Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human PPP2R5D (aa 483-580) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | DCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVY |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human PPP2R5D (aa 483-580) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human Transthyretin (aa 24-147) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | GTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE |
Concentration | 2.30 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human Transthyretin (aa 24-147) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human AARS2 (aa 635-708) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | THLLNWALRQTLGPGTEQQGSHLNPEQLRLDVTTQTPLTPEQLRAVENTVQEAVGQDEAVYMEEVPLALTAQVP |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human AARS2 (aa 635-708) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human EEF1E1 (aa 7-98) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | LSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDL |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human EEF1E1 (aa 7-98) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human SNX9 (aa 154-243) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | YQGPATGDDDDWDEDWDGPKSSSYFKDSESADAGGAQRGNSRASSSSMKIPLNKFPGFAKPGTEQYLLAKQLAKPKEKIPIIVGDYGPMW |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human SNX9 (aa 154-243) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human CEP162 (aa 1027-1126) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | LEKELDDIKEAHQITVRNLEAEIDVLKHQNAELDVKKNDKDDEDFQSIEFQVEQAHAKAKLVRLNEELAAKKREIQDLSKTVERLQKDRRMMLSNQNSKG |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human CEP162 (aa 1027-1126) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human VLK (aa 220-297) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | QDSEDIPDTLTTITELGAPVEMIQLLQTSWEDRFRICLSLGRLLHHLAHSPLGSVTLLDFRPRQFVLVDGELKVTDLD |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human VLK (aa 220-297) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human MEK1 (aa 1-58) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQ |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human MEK1 (aa 1-58) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human GPR52 (aa 230-265) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | CRQHTKEINDRRARFPSHEVDSSRETGHSPDRRYAM |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human GPR52 (aa 230-265) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human GPR174 (aa 156-183) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | RTSDDTSGNRTKCFVDLPTRNVNLAQSV |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human GPR174 (aa 156-183) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human C14orf100 (aa 115-147) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | LYIRSCRVLMLSDWYTMLYNPSPDYVTTVHCTH |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human C14orf100 (aa 115-147) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human CTNNBL1 (aa 214-304) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | GVHNTLAIVENMAEFRPEMCTEGAQQGLLQWLLKRLKAKMPFDANKLYCSEVLAILLQDNDENRELLGELDGIDVLLQQLSVFKRHNPSTA |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human CTNNBL1 (aa 214-304) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human PHF20 (aa 537-638) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | VRVKPKKKKKKKKKTKPECPCSEEISDTSQEPSPPKAFAVTRCGSSHKPGVHMSPQLHGPESGHHKGKVKALEEDNLSESSSESFLWSDDEYGQDVDVTTNP |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human PHF20 (aa 537-638) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human GPR10 (aa 23-60) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | TTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLK |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human GPR10 (aa 23-60) Control Fragment |
Recombinant | Recombinant |